PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009758643.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 410aa    MW: 45811.8 Da    PI: 8.8643
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009758643.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.53.3e-50331591128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     + pGfrF+Ptdeel+++yLkkk+eg++  + evi+ev+i k+ePwdLp k+v ++++ew+fFs+r +ky++g++++rat+sgyWkatgk+++v+s
  XP_009758643.1  33 MFPGFRFSPTDEELISYYLKKKLEGSDKCV-EVISEVEIWKHEPWDLPaKSVIQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGKERNVKS 126
                     579************************777.99***************667777899************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++l+g+k+tLvf++grapkg++t+W+mhey +
  XP_009758643.1 127 -GSNLIGTKRTLVFHTGRAPKGQRTHWIMHEYCM 159
                     .9******************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-5629176IPR003441NAC domain
PROSITE profilePS5100554.45333177IPR003441NAC domain
PfamPF023652.4E-2635158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MVDGHVSAGS RNENGTTPRN NNVEISIATA SSMFPGFRFS PTDEELISYY LKKKLEGSDK  60
CVEVISEVEI WKHEPWDLPA KSVIQSDNEW FFFSPRGRKY PNGSQSKRAT ESGYWKATGK  120
ERNVKSGSNL IGTKRTLVFH TGRAPKGQRT HWIMHEYCMS GNTNYQDSMV VCRLRKNSEF  180
HLNDTPRNQR NQLAATATAT AQSGAGQLGS LELVTVGDCC CSKEGSSSFY SHSVEQIDSG  240
SESDKPTKEF SQHDSSGHFK DCDGEEDWFA DIMKDDIIKL DESSLNAQPI SMVPSRPESS  300
ISTHEARAAM SGVAPFQGTA NRRLRLVREK VVVCPVEGSR MYEATKKNKI GVSITSSGRW  360
LRNMFSVKTM KQYVMPIFLV AFILLVMLLS MLGVSQQVKW LRRVLVLTSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D7e-452417711168NAC domain-containing protein 19
3swp_C7e-452417711168NAC domain-containing protein 19
3swp_B7e-452417711168NAC domain-containing protein 19
3swp_A7e-452417711168NAC domain-containing protein 19
3swm_D7e-452417711168NAC domain-containing protein 19
3swm_C7e-452417711168NAC domain-containing protein 19
3swm_B7e-452417711168NAC domain-containing protein 19
3swm_A7e-452417711168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-109HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758643.10.0PREDICTED: NAC domain-containing protein 89-like
RefseqXP_016449980.10.0PREDICTED: NAC domain-containing protein 89-like
TrEMBLM1A5E50.0M1A5E5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000150770.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.18e-84NAC domain containing protein 89